PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g019668m
Common NameCISIN_1g019668mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 338aa    MW: 36610.8 Da    PI: 9.2456
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g019668mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.6e-3972132262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +e+alkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  orange1.1g019668m  72 PETALKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 132
                        67899*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3156121IPR003851Zinc finger, Dof-type
PfamPF027011.0E-3275130IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60976130IPR003851Zinc finger, Dof-type
PROSITE patternPS01361078114IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MVFSSVPVYL DPPNWQQQQP THHQPQGGGG GIDGSQLPLP PMLPMGSGGG STGAIRPNSM  60
TERARMAKMP QPETALKCPR CESTNTKFCY FNNYSLSQPR HFCKTCRRYW TRGGALRNVP  120
VGGGCRRNKR SKGRNSRSKS PAVTEGQATA GTSSSSALSS RNIIGRMQNP QQQIPMLPNL  180
HHLNDYNSSD IGLNFGGIQI PSQGVACNGN DIGFQVANGT SNSGSILSSG LVEQWKLQQF  240
PFLSNGLEQV TGLYPFDTEI MEPQSYTIGQ LRSKSAALDS EATQFANVKM EDNTQSLNLS  300
RNFLGINSAN DHQYWGTNNN AWSDLSGFTS SSTSHLL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436002.10.0hypothetical protein CICLE_v10032039mg
RefseqXP_006486095.10.0PREDICTED: dof zinc finger protein DOF3.6
SwissprotQ9M2U14e-71DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLA0A067FW230.0A0A067FW23_CITSI; Uncharacterized protein
STRINGPOPTR_0010s21240.11e-109(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17132886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.12e-52OBF-binding protein 3